PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G168800.1.p
Common NameLOC101756470, SETIT_036905mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 288aa    MW: 30502.1 Da    PI: 6.9205
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G168800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.93e-4271061100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp ++p+kfanvh++FGasnv+kll++lp+ +reda++sl+yeAear+rdPvyG+v+ i+ lq +++q++
  Seita.9G168800.1.p   7 PCAACKLLRRKCTQGCVFAPYFPPDNPAKFANVHRVFGASNVSKLLNELPQAQREDAVNSLAYEAEARLRDPVYGCVSYISVLQLRIKQAR 97 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          ela++++e
  Seita.9G168800.1.p  98 DELAAARKE 106
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6446107IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSSSSSPCAA CKLLRRKCTQ GCVFAPYFPP DNPAKFANVH RVFGASNVSK LLNELPQAQR  60
EDAVNSLAYE AEARLRDPVY GCVSYISVLQ LRIKQARDEL AAARKELASY IGPAAFAPFV  120
APPQYHHHQY AGVPLASGAG MGLGVGVAPQ HGHGHPQQQI MVQHQQHLHH HQQMAEAQQL  180
AATVEVAREQ ELMMRQAAAY AHAVPGSSAG ATVAVVPPDA VPYEGGFLFQ QQQQPPPSQA  240
QTAVALTYQM EQSPPPSSSG QSHPEVSHQQ NTDGSDEGSG GGGVPPA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1369721e-122AC136972.3 Oryza sativa chromosome 3 BAC OSJNBb0007E22 genomic sequence, complete sequence.
GenBankAP0149591e-122AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126111e-122CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012704292.10.0PREDICTED: LOB domain-containing protein 6
TrEMBLK4ADE80.0K4ADE8_SETIT; Uncharacterized protein
STRINGSi036905m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-57ASYMMETRIC LEAVES 2-like 1